	US 12,134,662 B2
	Synthetic proteins and therapeutic uses thereof
Erik D'Hondt, Bazel (BE); and Keith Alan Charlton, Aberdeenshire (GB)
Assigned to In3Bio Ltd., Hamilton (BM)
Appl. No. 16/631,690
Filed by IN3BIO LTD., Hamilton (BM)
PCT Filed Jul. 18, 2018, PCT No. PCT/IB2018/000898 § 371(c)(1), (2) Date Jan. 16, 2020, PCT Pub. No. WO2019/016597, PCT Pub. Date Jan. 24, 2019.
Claims priority of provisional application 62/533,901, filed on Jul. 18, 2017.
Prior Publication US 2021/0009716 A1, Jan. 14, 2021
Int. Cl. C07K 19/00 (2006.01); A61K 38/18 (2006.01); C07K 14/28 (2006.01); C07K 14/485 (2006.01); C07K 14/495 (2006.01)

CPC C07K 19/00 (2013.01) [A61K 38/1883 (2013.01); C07K 14/28 (2013.01); C07K 14/485 (2013.01); C07K 14/495 (2013.01); C07K 2319/30 (2013.01)]

19 Claims

1. A synthetic protein, comprising:

a synthetic Epidermal Growth Factor (sEGF) growth factor comprising at least one synthetic targeted signaling pathway (sTSP) domain of a human Epidermal Growth Factor (hEGF) TSP (hTSP) domain, wherein the at least one sTSP is 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence NTENDCPLSHEAYCLHDGVCMYIEALDKYACNCVVGYVGERCQFRDLRWWDAR (SEQ ID NO: 33), excluding the following amino acid changes: T2S, E3D, N4S, DSE, E11D, A12G, V38I, F44Y, R48K, F511, and A52L;

at least one linker; and

an immunogenic polypeptide, wherein the at least one linker includes a first linker that separates the sTSP from the immunogenic polypeptide.