	US 12,433,936 B2
	High-purity adrenocorticotropic hormone analogue and a large-scale preparation method thereof
Jundong Meng, Nanjing (CN); Tao Yang, Nanjing (CN); Feifei Wu, Nanjing (CN); and Haoning Zhang, Nanjing (CN)
Assigned to Nanjing Hanxin Pharmaceutical Technology Co., Ltd., Nanjing (CN)
Filed by Nanjing Hanxin Pharmaceutical Technology Co., Ltd., Nanjing (CN)
Filed on Aug. 19, 2022, as Appl. No. 17/891,946.
Application 17/891,946 is a continuation in part of application No. 17/357,255, filed on Jun. 24, 2021, granted, now 11,419,919.
Claims priority of application No. PCT/CN2021/086395 (WO), filed on Apr. 12, 2021.
Prior Publication US 2022/0401521 A1, Dec. 22, 2022
This patent is subject to a terminal disclaimer.
Int. Cl. A61K 38/22 (2006.01); A61K 38/00 (2006.01); A61K 38/35 (2006.01); C07K 14/00 (2006.01)

CPC A61K 38/22 (2013.01)

22 Claims

1. A method of treating spasm, wherein the method comprises administering a composition comprising an adrenocorticotropic hormone (ACTH) analogue, wherein the amino acid sequence of the adrenocorticotropic hormone analogue comprises the amino acid sequence of

	(SEQ ID NO: 4)
	SYSMEHFRWGKPVGKKRRPVKVYPDGAEDESAEAFPLEF.