	US 12,345,709 B2
	CLAUDIN18 antibodies and methods of treating cancer
Dylan Conklin, Los Angeles, CA (US); Martina S. McDermott, Los Angeles, CA (US); Neil A. O'Brien, Los Angeles, CA (US); Michael J. Palazzolo, Los Angeles, CA (US); and Dennis Slamon, Los Angeles, CA (US)
Assigned to The Regents of the University of California, Oakland, CA (US)
Appl. No. 17/627,540
Filed by The Regents of the University of California, Oakland, CA (US)
PCT Filed Jul. 17, 2020, PCT No. PCT/US2020/042573 § 371(c)(1), (2) Date Jan. 14, 2022, PCT Pub. No. WO2021/011885, PCT Pub. Date Jan. 21, 2021.
Claims priority of provisional application 62/875,416, filed on Jul. 17, 2019.
Prior Publication US 2022/0372133 A1, Nov. 24, 2022
This patent is subject to a terminal disclaimer.
Int. Cl. G01N 33/574 (2006.01); A61K 47/68 (2017.01); A61P 1/18 (2006.01); A61P 35/00 (2006.01); C07K 16/28 (2006.01); G01N 33/68 (2006.01); A61K 39/00 (2006.01)

CPC G01N 33/57407 (2013.01) [A61K 47/68031 (2023.08); A61K 47/6849 (2017.08); A61P 1/18 (2018.01); A61P 35/00 (2018.01); C07K 16/28 (2013.01); C07K 16/2809 (2013.01); G01N 33/57438 (2013.01); G01N 33/57492 (2013.01); G01N 33/68 (2013.01); A61K 2039/505 (2013.01); C07K 2317/24 (2013.01); C07K 2317/31 (2013.01); C07K 2317/56 (2013.01); C07K 2317/77 (2013.01); C07K 2317/92 (2013.01)]

15 Claims

1. An antigen-binding protein that binds to a human Claudin 18.2 (CLDN 18.2) protein (SEQ ID NO: 1) comprising:

a. CDR1-3 derived from a heavy chain variable region comprising the amino acid sequence: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYTMSWVRQAPGKGLEWVA TIIIGGSYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRLV KGNAMDYWGQGTLVTVSS (SEQ ID NO 42) or a variant sequence thereof which differs by 1-5 amino acids; and

b. CDR1-3 derived from a light chain variable region comprising the amino acid sequence: DIVMTQSPDSLAVSLGERVTMNCKSSQSLLNSGNQKNYLSWYQQKPGQP PKLLFYWASTRESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCONDYS YPFTFGQGTKLEIK (SEQ ID NO 45) or a variant sequence thereof which differs by 1-5 amino acids.