US 12,343,402 B2
Method of determining the identity and/or amount of an anti-IL-31 antibody in a sample
Gary Francis Bammert, Portage, MI (US); and Steven Alan Dunham, Kalamazoo, MI (US)
Assigned to Zoetis Services LLC, Parsippany, NJ (US)
Filed by Zoetis Services LLC, Parsippany, NJ (US)
Filed on Jul. 28, 2022, as Appl. No. 17/815,681.
Application 17/815,681 is a division of application No. 16/356,505, filed on Mar. 18, 2019, granted, now 11,433,139.
Claims priority of provisional application 62/643,921, filed on Mar. 16, 2018.
Prior Publication US 2022/0362391 A1, Nov. 17, 2022
Int. Cl. G01N 33/68 (2006.01); A61K 38/12 (2006.01); A61K 39/00 (2006.01); A61K 39/385 (2006.01); A61K 47/64 (2017.01)
CPC A61K 47/646 (2017.08) [A61K 38/12 (2013.01); A61K 39/0008 (2013.01); A61K 39/00114 (2018.08); A61K 39/385 (2013.01); A61K 47/6415 (2017.08); A61K 47/642 (2017.08); G01N 33/6854 (2013.01); G01N 33/6869 (2013.01); A61K 2039/552 (2013.01); A61K 2039/55505 (2013.01); A61K 2039/577 (2013.01); A61K 2039/6037 (2013.01)] 8 Claims
 
1. A method of determining the identity and/or amount of an anti-IL-31 antibody in a sample, the method comprising
incubating a sample comprising an anti-IL-31 antibody with at least one IL-31 mimotope, wherein said IL-31 mimotope is:
i) a parent equine IL-31 mimotope which is a peptide from 5 to 40 amino acid residues in length and is and/or comprises as part thereof an amino acid sequence selected from the group consisting of SMPTDNFERKRF (SEQ ID NO: 189), NSSAILPYFKAISPSLNNDKSLYIIEQLDKLNF (SEQ ID NO: 194), GPIYQLQPKEIQAIIVELONLS KK (SEQ ID NO: 198), and KGVQKF (SEQ ID NO: 202); or
ii) a variant IL-31 mimotope which is a peptide from about 5 to about 40 amino acid residues in length and has at least 50% amino acid sequence identity with said parent equine IL-3 mimotope except for one or more amino acid substitutions within said amino acid sequence, wherein said variant IL-3 mimotope retains anti-IL-31 binding; and
determining the identity and/or quantity of the anti-IL-31 in the sample.