| CPC A61K 47/646 (2017.08) [A61K 38/12 (2013.01); A61K 39/0008 (2013.01); A61K 39/00114 (2018.08); A61K 39/385 (2013.01); A61K 47/6415 (2017.08); A61K 47/642 (2017.08); G01N 33/6854 (2013.01); G01N 33/6869 (2013.01); A61K 2039/552 (2013.01); A61K 2039/55505 (2013.01); A61K 2039/577 (2013.01); A61K 2039/6037 (2013.01)] | 8 Claims |
|
1. A method of determining the identity and/or amount of an anti-IL-31 antibody in a sample, the method comprising
incubating a sample comprising an anti-IL-31 antibody with at least one IL-31 mimotope, wherein said IL-31 mimotope is:
i) a parent equine IL-31 mimotope which is a peptide from 5 to 40 amino acid residues in length and is and/or comprises as part thereof an amino acid sequence selected from the group consisting of SMPTDNFERKRF (SEQ ID NO: 189), NSSAILPYFKAISPSLNNDKSLYIIEQLDKLNF (SEQ ID NO: 194), GPIYQLQPKEIQAIIVELONLS KK (SEQ ID NO: 198), and KGVQKF (SEQ ID NO: 202); or
ii) a variant IL-31 mimotope which is a peptide from about 5 to about 40 amino acid residues in length and has at least 50% amino acid sequence identity with said parent equine IL-3 mimotope except for one or more amino acid substitutions within said amino acid sequence, wherein said variant IL-3 mimotope retains anti-IL-31 binding; and
determining the identity and/or quantity of the anti-IL-31 in the sample.
|