| CPC C07K 14/62 (2013.01) | 9 Claims |
|
1. A novel short-proinsulin aspart sequence for preparing recombinant insulin aspart and analogs thereof, wherein the sequence has an amino acid sequence as shown in Formula I:
R-R1-(B1-B27)-B28-B29-B30-R2-(A1-A21),
wherein R-R1 is a leading peptide sequence, which meets the following conditions:
(a) R is one part of super oxide dismutase (SOD) homolog, which consists of 63 amino acids including active methionine; and two cysteine (C) residues are substituted by serine(S);
wherein, the sequence of R is SEQ ID NO: 1:
| |||||
(b) the leading peptide does not affect refolding of short-proinsulin aspart and can be cleaved;
(c) R1 is any one of Arg and Lys,
R2 is a C-peptide, which consists of any one from Arg or Lys;
B1-B27 denotes an amino acid sequence of B1 to B27 in B-chain of native human insulin;
A1-A21 denotes an A-chain of native human insulin;
B28 is Aspartic acid;
B29 is Lysine; and
B30 is Threonine;
the sequence of (B1-B27)-B28-B29-B30-R2-(A1-A21) is one of SEQ ID NO: 12 or SEQ ID NO: 13;
a sequence of SEQ ID NO: 12 is:
FVNQHLCGSHLVEALYLVCGERGFFYTDKTRGIVEQCCTSICSLYQLENYCN; and
a sequence of SEQ ID NO: 13 is:
| |||||