	US 12,312,383 B2
	Animal pathogen-derived polypeptides and uses thereof for genetic engineering
Fyodor Urnov, Seattle, WA (US); John A. Stamatoyannopoulos, Seattle, WA (US); and Alister P W Funnell, Seattle, WA (US)
Assigned to Altius Institute for Biomedical Sciences, Seattle, WA (US)
Appl. No. 17/047,373
Filed by ALTIUS INSTITUTE FOR BIOMEDICAL SCIENCES, Seattle, WA (US)
PCT Filed Apr. 18, 2019, PCT No. PCT/US2019/028174 § 371(c)(1), (2) Date Oct. 13, 2020, PCT Pub. No. WO2019/204643, PCT Pub. Date Oct. 24, 2019.
Claims priority of provisional application 62/819,237, filed on Mar. 15, 2019.
Claims priority of provisional application 62/738,825, filed on Sep. 28, 2018.
Claims priority of provisional application 62/716,223, filed on Aug. 8, 2018.
Claims priority of provisional application 62/690,905, filed on Jun. 27, 2018.
Claims priority of provisional application 62/659,656, filed on Apr. 18, 2018.
Prior Publication US 2021/0115093 A1, Apr. 22, 2021
Int. Cl. C07K 19/00 (2006.01); C07K 14/195 (2006.01)

CPC C07K 14/195 (2013.01) [C07K 2319/80 (2013.01)]

20 Claims

1. A recombinant polypeptide comprising a nucleic acid binding domain (NBD) and a heterologous functional domain, the NBD comprising a plurality of repeat units (RUs), wherein each RU comprises a 33-36 amino acid long sequence that is at least 85% identical to:

	(SEQ ID NO: 9)
	FNAEQIVRMVSHDGGSLNLKAVIDNHDDLKNMG

and

comprises base-contacting residues (BCR) at amino acid positions 12 and 13 (X₁₂X₁₃) numbered relative to SEQ ID NO:9, wherein X₁₂X₁₃=HK, HD, HA, HN, HG, NN, NG, RN, HI, HV, RT, SN, HS, GS, or LN,

wherein the RUs are ordered from N-terminus to C-terminus of the NBD to bind to a target sequence, and

wherein the polypeptide comprises an N-terminal domain and a C-terminal domain, wherein the C-terminus of the N-terminal domain is fused to the N-terminus of the first RU of the NBD and wherein the N-terminus of the C-terminal domain is fused to the C-terminus of the last RU of the NBD.