	US 12,263,350 B2
	Light-responsive polypeptides and methods of use thereof
Karl A. Deisseroth, Stanford, CA (US); Yoon Kim, Stanford, CA (US); Hideaki Kato, Stanford, CA (US); Charu Ramakrishnan, Stanford, CA (US); and Susumu Yoshizawa, Tokyo (JP)
Assigned to The Board of Trustees of the Leland Stanford Junior University, Stanford, CA (US)
Appl. No. 17/421,346
Filed by The Board of Trustees of the Leland Stanford Junior University, Stanford, CA (US); and The University of Tokyo, Tokyo (JP)
PCT Filed Jan. 10, 2020, PCT No. PCT/US2020/013098 § 371(c)(1), (2) Date Jul. 7, 2021, PCT Pub. No. WO2020/150093, PCT Pub. Date Jul. 23, 2020.
Claims priority of provisional application 62/792,297, filed on Jan. 14, 2019.
Prior Publication US 2022/0118271 A1, Apr. 21, 2022
Int. Cl. C07K 14/705 (2006.01); A61N 5/06 (2006.01); C12N 13/00 (2006.01); A61N 5/067 (2006.01)

CPC A61N 5/062 (2013.01) [A61N 5/0601 (2013.01); C07K 14/705 (2013.01); C12N 13/00 (2013.01); A61N 2005/063 (2013.01); A61N 2005/0652 (2013.01); A61N 2005/0663 (2013.01); A61N 5/067 (2021.08); C07K 2319/04 (2013.01); C07K 2319/10 (2013.01)]

22 Claims

1. A light-activated polypeptide that comprises an amino acid sequence having at least 99% amino acid sequence identity to the following amino acid sequence:

(SEQ ID NO: 1)
MAHAPGTDQMFYVGTMDGWYLDTKLNSVAIGAHWSCFIVLTITTFYLGYE

SWTSRGPSKRTSFYAGYQEEQNLALFVNFFAMLSYFGKIVADTLGHNFGD

VGPFIIGFGNYRYADYMLTCPMLVYDLLYQLRAPYRVSCSAIIFAILMSG

VLAEFYAEGDPRLRNGAYAWYGFGCFWFIFAYSIVMSIVAKQYSRLAQLA

QDTGAEHSLHVLKFAVFTFSMLWILFPLVWAICPRGFGWIDDNWTEVAHC

VCDIVAKSCYGFALARFRKTYDEELFRLLEQLGHDEDEFQKLELDMRLSS

NGERLRRLS;

and

a heterologous membrane trafficking signal.