	US 12,240,881 B2
	Ultra-long acting insulin-Fc fusion protein and methods of use
Thomas M. Lancaster, Wenham, MA (US); and Todd C. Zion, Marblehead, MA (US)
Assigned to Dechra Limited, Skipton (GB)
Filed by DECHRA LIMITED, Skipton (GB)
Filed on Oct. 13, 2023, as Appl. No. 18/486,310.
Application 18/486,310 is a continuation of application No. 17/527,486, filed on Nov. 16, 2021, granted, now 11,814,418.
Application 17/527,486 is a continuation of application No. 17/226,847, filed on Apr. 9, 2021, granted, now 11,192,930, issued on Dec. 7, 2021.
Claims priority of provisional application 63/008,520, filed on Apr. 10, 2020.
Prior Publication US 2024/0101636 A1, Mar. 28, 2024
This patent is subject to a terminal disclaimer.
Int. Cl. C07K 14/62 (2006.01); A61K 38/00 (2006.01)

CPC C07K 14/62 (2013.01) [A61K 38/00 (2013.01); C07K 2319/30 (2013.01)]

10 Claims

1. A method for lowering the blood glucose of a target animal, the method comprising administering a physiologically effective amount of a fusion protein or a pharmaceutical composition thereof to the target animal, said fusion protein comprising an insulin polypeptide and an Fc fragment, wherein the insulin polypeptide and the Fc fragment are connected by a peptide linker, wherein the Fc fragment comprises the following sequence:

(SEQ ID NO: 21)
GEGPKCPVPEIPGAPSVFIFPPKPKDTLSISRTPEVTCLVVDLGPDDSNV

QITWFVDNTEMHTAKTRPREEQFKSTYRVVSVLPILHQDWLKGKEFKCKV

NSKSLPSAMERTISKAKGQPHEPQVYVLPPTQEELSENKVSVTCLIKGFH

PPDIAVEWEITGQPEPENNYQTTPPQLDSDGTYFLYSRLSVDRSHWQRGN

TYTCSVSHEALHSHHTQKSLTQSPG.

wherein the insulin polypeptide comprises the following sequence:

(SEQ ID NO: 4)
FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLY

QLENYCN.

and

wherein the target animal is a cat.