	US 12,239,720 B2
	Compositions for use in lysis of selective cancer cells
Steven Evans, New York, NY (US)
Assigned to Oncolyze, Inc., New York, NY (US)
Appl. No. 17/045,620
Filed by ONCOLYZE, INC., New York, NY (US)
PCT Filed Apr. 8, 2019, PCT No. PCT/US2019/026390 § 371(c)(1), (2) Date Oct. 6, 2020, PCT Pub. No. WO2019/195851, PCT Pub. Date Oct. 10, 2019.
Claims priority of provisional application 62/653,808, filed on Apr. 6, 2018.
Prior Publication US 2021/0128754 A1, May 6, 2021
Int. Cl. A61K 38/03 (2006.01); A61K 38/10 (2006.01); A61K 38/16 (2006.01); A61K 38/17 (2006.01); A61K 49/14 (2006.01); A61P 35/00 (2006.01)

CPC A61K 49/14 (2013.01) [A61K 38/10 (2013.01); A61K 38/17 (2013.01); A61P 35/00 (2018.01)]

4 Claims

1. A method of treating cancer in a subject in need thereof, comprising:

i) measuring the amount of a serum biomarker pre-treatment,

ii) administering to the subject a therapeutically effective amount of a composition comprising a human double minute binding domain (HDM-2) targeting component and a membrane resident component (MRC), and

iii) measuring the amount of the serum biomarker post-treatment;

wherein the cancer is acute myeloid leukemia (AML),

wherein the HDM-2 targeting component is a peptide selected from the group consisting of PPLSQETFSDLWKLL (SEQ ID NO:1) and ETFSDLWKLL (SEQ ID NO:2),

wherein the MRC is the peptide KKWKMRRNQFWVKVQRG (SEQ ID NO:25),

wherein the HDM-2 targeting component is attached to the MRC,

wherein an increase in the amount of the serum biomarker from pre-treatment to post-treatment is indicative of necrosis, membranolysis, or poration of said cancer,

wherein said composition comprises a peptide of:

	(SEQ ID NO: 48)
	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG or

	(SEQ ID NO: 49)
	ETFSDLWKLLKKWKMRRNQFWVKVQRG,

and

wherein the serum biomarker is cytokeratin.