	US 11,814,418 B2
	Ultra-long acting insulin-Fc fusion protein and methods of use
Thomas M. Lancaster, Wenham, MA (US); and Todd C. Zion, Marblehead, MA (US)
Assigned to Akston Biosciences Corporation, Beverly, MA (US)
Filed by Akston Biosciences Corporation, Beverly, MA (US)
Filed on Nov. 16, 2021, as Appl. No. 17/527,486.
Application 17/527,486 is a continuation of application No. 17/226,847, filed on Apr. 9, 2021, granted, now 11,192,930.
Claims priority of provisional application 63/008,520, filed on Apr. 10, 2020.
Prior Publication US 2022/0056098 A1, Feb. 24, 2022
This patent is subject to a terminal disclaimer.
Int. Cl. C07K 14/62 (2006.01); A61K 38/00 (2006.01)

CPC C07K 14/62 (2013.01) [A61K 38/00 (2013.01); C07K 2319/30 (2013.01)]

14 Claims

1. A recombinant cell comprising a nucleic acid encoding a fusion protein, said fusion protein comprising an insulin polypeptide and an Fc fragment, wherein the insulin polypeptide and the Fc fragment are connected by a peptide linker, wherein the Fc fragment comprises the following sequence:

(SEQ ID NO: 21)
GEGPKCPVPEIPGAPSVFIFPPKPKDTLSISRTPEVTCLVVDLGPDDSNV

QITWFVDNTEMHTAKTRPREEQFKSTYRVVSVLPILHQDWLKGKEFKCKV

NSKSLPSAMERTISKAKGQPHEPQVYVLPPTQEELSENKVSVTCLIKGFH

PPDIAVEWEITGQPEPENNYQTTPPQLDSDGTYFLYSRLSVDRSHWQRGN

TYTCSVSHEALHSHHTQKSLTQSPG.

and wherein the insulin polypeptide comprises the following sequence:

(SEQ ID NO: 4)
FVNQHLCGSDLVEALYLVCGERGFFYTDPTGGGPRRGIVEQCCHSICSLY

QLENYCN.