US 11,939,369 B2
Integrin antagonists
M. Amin Arnaout, Chestnut Hill, MA (US)
Assigned to The General Hospital Corporation, Boston, MA (US)
Filed by The General Hospital Corporation, Boston, MA (US)
Filed on Jul. 30, 2021, as Appl. No. 17/390,653.
Application 17/390,653 is a continuation of application No. 16/575,009, filed on Sep. 18, 2019, abandoned.
Application 16/575,009 is a continuation of application No. 15/109,602, granted, now 10,533,044, issued on Jan. 14, 2020, previously published as PCT/US2015/010384, filed on Jan. 6, 2015.
Claims priority of provisional application 61/968,989, filed on Mar. 21, 2014.
Claims priority of provisional application 61/925,548, filed on Jan. 9, 2014.
Claims priority of provisional application 61/924,103, filed on Jan. 6, 2014.
Prior Publication US 2022/0153812 A1, May 19, 2022
Int. Cl. C07K 14/78 (2006.01); A61K 38/00 (2006.01); C07K 7/06 (2006.01); C07K 7/08 (2006.01); C07K 7/64 (2006.01); C07K 14/47 (2006.01)
CPC C07K 14/78 (2013.01) [C07K 7/06 (2013.01); C07K 7/08 (2013.01); C07K 7/64 (2013.01); C07K 14/47 (2013.01); A61K 38/00 (2013.01)] 12 Claims
 
1. A polypeptide consisting of the sequence
(SEQ ID NO: 9)
SDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVP
 
GSKSTATISGLKPGVDYTITVYAVTPRGDWNEGSKPISINY.